PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_113824g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 337aa    MW: 37686.6 Da    PI: 4.4479
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_113824g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.72.7e-132976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd +l+  + ++G g+W+  a   g++Rt+k+c++rw +yl
   MA_113824g0010 29 KGPWTVEEDMQLIGSISLHGEGRWSFLAGAAGLKRTGKSCRLRWVNYL 76
                     79********************************************97 PP

2Myb_DNA-binding43.95.3e-1482125146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r + T eE+ l++++++++G+  W++Ia+ ++ gRt++++k++w++
   MA_113824g0010  82 RSKITREEERLIIELHRRWGNM-WSRIAQSLP-GRTDNEIKNFWRT 125
                      56789*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.572476IPR017930Myb domain
SuperFamilySSF466891.17E-2727123IPR009057Homeodomain-like
SMARTSM007176.7E-122878IPR001005SANT/Myb domain
PfamPF002493.6E-122976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-213083IPR009057Homeodomain-like
CDDcd001673.06E-93176No hitNo description
PROSITE profilePS5129422.45677131IPR017930Myb domain
SMARTSM007176.8E-1281129IPR001005SANT/Myb domain
PfamPF002499.6E-1383125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2284131IPR009057Homeodomain-like
CDDcd001672.47E-1086125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MVSSVNLMAN RTWWGGSDID DEIEAETRKG PWTVEEDMQL IGSISLHGEG RWSFLAGAAG  60
LKRTGKSCRL RWVNYLRPDL KRSKITREEE RLIIELHRRW GNMWSRIAQS LPGRTDNEIK  120
NFWRTRMKGK LNVEAEKGIG GMDTDNGVHF EPSTGSYCLP VTSSQIPSEL DIAEPSSSFP  180
RQNAEEITVQ TITTPYLQDD IFSQVITSSE GNSENVLQGG EIHGHSQSND DGQAGETITE  240
HLDGSDSLFE NTRLPYTFSV GSLVNLLSSE FFADSATQDC KIPPLSSYVL GSPEAFSDSE  300
SYCESYLSCY SDVLWNMDEE DNRFIPSRQP AAAGRLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C4e-28291314105C-Myb DNA-Binding Domain
1mse_C4e-28291314105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006470308.12e-52PREDICTED: myb-related protein 305
SwissprotQ9SPG92e-50MYB24_ARATH; Transcription factor MYB24
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.12e-45myb domain protein 24